PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9814_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 364aa    MW: 41029.6 Da    PI: 4.7295
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9814_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.7e-1980133356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Neem_9814_f_1  80 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 133
                    566899***********************************************9 PP

2HD-ZIP_I/II129.11.8e-4179171193
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                    ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++y+alk + ++L++++e+L +e+ke
  Neem_9814_f_1  79 EKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYEALKLNYDTLQHDNEALLKEIKE 171
                    69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.21E-1971137IPR009057Homeodomain-like
PROSITE profilePS5007117.44375135IPR001356Homeobox domain
SMARTSM003896.3E-1878139IPR001356Homeobox domain
PfamPF000464.3E-1680133IPR001356Homeobox domain
CDDcd000869.46E-1780136No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2082142IPR009057Homeodomain-like
PRINTSPR000311.1E-5106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5115131IPR000047Helix-turn-helix motif
PfamPF021834.2E-17135176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGSEVGRVLK RVRRDVEDKR DMKRSLGSSD SLGALMPICP TTDERSPRNN HVYGREFQTM  60
LDGLDEEGCL EESGGHVSEK KRRLSVDQVK ALEKNFEVEN KLEPERKVKL AQELGLQPRQ  120
VAVWFQNRRA RWKTKQLERD YGVLKANYEA LKLNYDTLQH DNEALLKEIK ELKSKLNEEN  180
TESINPVKEE KVLLVHETDN KTTTLQEESN KLPALVTSSL AAASDPDQEL NYESFNNNDN  240
GVLGGISLFP ADFKDGSSDS DSSAILNEDN SPNAAISSSA TTGIIQNQHH LDLLMSPTSS  300
SLKHSPPPSI NCFEFSKPTY QAQFVKMEEH NFFGDEACNF FSDDQAPSLP WYCSDQWTSL  360
ETPL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00587DAPTransfer from AT5G65310Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466270.11e-161PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A067EZZ71e-160A0A067EZZ7_CITSI; Uncharacterized protein
TrEMBLV4SL151e-160V4SL15_9R
STRINGVIT_07s0191g00180.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-64homeobox protein 6